Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 9-53 45 1-8, 54-59 8 6 knot
Fingerprint Knot forming loop Loop type
K +31 Cys8 ... Cys10 <-> Cys95 ... Cys88 <-> Cys140 ... Cys161 <-> Cys60 ... Cys65 <-> Cys121 ... Cys134 <-> Cys172 ... Cys167 <-> Cys8 covalent
K -31
Chain closureAla1 <-> Phe175
... Cys170 <-> Cys127 ... Cys95 <-> Cys10 ... Cys60 <-> Cys161 ... Cys140 <-> Cys88 ... Cys75 <-> Cys168 ... Cys167 <-> Cys8 ... Ala1		 probabilistic
K -31
Chain closureAla1 <-> Phe175
... Cys170 <-> Cys127 ... Cys121 <-> Cys65 ... Cys60 <-> Cys161 ... Cys140 <-> Cys88 ... Cys75 <-> Cys168 ... Cys167 <-> Cys8 ... Ala1		 probabilistic
Chain Sequence
ADTNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKSECPVSTRDCEPVFGYTVAGEFRVIVQAPRAGFRQCVWQHKCRFGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling