1CCS | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K

Help Knotting data interpretation

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	12-253	242	1-11, 254-256			11	2	slipknot
view details	+ 3₁	23-152	130	1-22, 153-155			22	2	slipknot
view details	+ 3₁	18-232	215	233-235	1-1	2-17	1	2	slipknot
view details	+ 3₁	21-150	130	1-20, 151-153			20	3	knot
view details	+ 3₁	22-175	154	1-21, 176-178			21	3	knot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> Asp199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> Asp199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His119 <-> Bridging ionZn262 <-> Asp199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence

Chain Sequence

WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLDTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling