1CCT | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K

Help Knotting data interpretation

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	21-253	233	254-256	1-2	3-20	2	2	slipknot
view details	+ 3₁	23-232	210	233-235	1-3	4-22	3	2	slipknot
view details	+ 3₁	22-152	131	1-21, 153-155			21	3	knot
view details	+ 3₁	15-230	216	1-14, 231-233			14	3	knot
view details	+ 3₁	23-150	128	151-153	1-1	2-22	1	2	slipknot
view details	+ 3₁	22-175	154	1-21, 176-178			21	3	knot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> Glu199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> Glu199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His119 <-> Bridging ionZn262 <-> Glu199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence

Chain Sequence

WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLETPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling