1CNC | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K

Help Knotting data interpretation

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	21-253	233	254-256	1-2	3-20	2	2	slipknot
view details	+ 3₁	21-231	211	232-235	1-1	2-20	1	3	slipknot
view details	+ 3₁	16-230	215	231-233	1-3	4-15	3	2	slipknot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	Trp5 ... Cys94 <-> Bridging ionZn262 <-> His96 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... Cys94 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence

Chain Sequence

WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFCFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling