Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 22-253 232 254-258 1-1 2-21 1 4 slipknot
Fingerprint Knot forming loop Loop type
K +31 His4 ... Val135 <->
Bridging ionHg262
<-> Gln137 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... Val135 <->
Bridging ionHg262
<-> Cys206 ...
Chain closureLys261 <-> His4
probabilistic
K +31 His4 ... Val135 <->
Bridging ionHg262
<-> Glu205 ...
Chain closureLys261 <-> His4
probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionHg262
<-> Gln137 ... His4
probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionHg262
<-> Gln137 ... His4
probabilistic
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIAFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling