1CVD | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K

Help Knotting data interpretation

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	18-253	236	1-17, 254-256			17	2	slipknot
view details	+ 3₁	19-233	215	1-18, 234-235			18	2	knot
view details	+ 3₁	19-230	212	231-233	1-1	2-18	1	2	slipknot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> Cys119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> Cys119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence

Chain Sequence

WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELCLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling