1DCA | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K

Help Knotting data interpretation

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	18-253	236	254-256	1-3	4-17	3	2	slipknot
view details	+ 3₁	23-233	211	1-22, 234-235			22	2	knot
view details	+ 3₁	26-152	127	153-155	1-1	2-25	1	2	slipknot
view details	+ 3₁	21-230	210	231-233	1-3	4-20	3	2	slipknot
view details	+ 3₁	25-149	125	1-24, 150-153			24	4	knot
view details	+ 3₁	24-175	152	1-23, 176-178			23	3	knot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> Cys199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> Cys199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His119 <-> Bridging ionZn262 <-> Cys199 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence

Chain Sequence

WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLCTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling