Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 3-235 233 1-2, 236-237 2 2 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGly25 <-> Arg261
... His96 <->
Bridging ionZn280
<-> His94 ... Gly25
probabilistic
K +31 Gly25 ... His96 <->
Bridging ionZn280
<-> His119 ...
Chain closureArg261 <-> Gly25
probabilistic
K +31 Gly25 ... His94 <->
Bridging ionZn280
<-> His119 ...
Chain closureArg261 <-> Gly25
probabilistic
Chain Sequence
GTRQSPINIQWKDSVYDPQLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEDSGISGGPLGNHYRLKQFHFHWGATDEWGSEHAVDGHTYPAELHLVHWNSTKYENYKKASVGENGLAVIGVFLKLGAHHQALQKLVDVLPEVRHKDTQVAMGPFDPSCLMPACRDYWTYPGSLTTPPLAESVTWIVQKTPVEVSPSQLSMFRTLLFSGRGEEEDVMVNNYRPLQPLRDRKLRSSFR

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling