1FR4 | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K

Help Knotting data interpretation

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	24-255	232	256-258	1-1	2-23	1	2	slipknot
view details	+ 3₁	24-233	210	234-237	1-2	3-23	2	3	slipknot
view details	+ 3₁	23-232	210	233-235	1-1	2-22	1	2	slipknot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	His4 ... His94 <-> Bridging ionCu262 <-> His96 ... Chain closureLys261 <-> His4	probabilistic	color sequence
knots details	K +3₁	His4 ... His96 <-> Bridging ionCu262 <-> His119 ... Chain closureLys261 <-> His4	probabilistic	color sequence
knots details	K +3₁	His4 ... His94 <-> Bridging ionCu262 <-> His119 ... Chain closureLys261 <-> His4	probabilistic	color sequence

Chain Sequence

HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQIHMHVGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling