Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 24-255 232 256-258 1-1 2-23 1 2 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closurePro3 <-> Phe260
... His96 <->
Bridging ionZn261
<-> His94 ... Pro3		 probabilistic
K +31 Pro3 ... His96 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Pro3
 probabilistic
K +31 Pro3 ... His94 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Pro3
 probabilistic
Chain Sequence
PDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling