1HEB | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K

Help Knotting data interpretation

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	24-186	163	1-23, 187-189			23	3	knot
view details	+ 3₁	14-253	240	254-256	1-2	3-13	2	2	slipknot
view details	+ 3₁	18-232	215	233-235	1-2	3-17	2	2	slipknot
view details	+ 3₁	23-230	208	231-233	1-3	4-22	3	2	slipknot
view details	+ 3₁	21-187	167	1-20, 188-190			20	3	knot
view details	+ 3₁	23-186	164	1-22, 187-189			22	3	knot
view details	+ 3₁	22-164	143	1-21, 165-168			21	4	knot
view details	+ 3₁	24-162	139	1-23, 163-166			23	4	knot
view details	+ 3₁	23-188	166	1-22, 189-190			22	2	knot
view details	+ 3₁	23-166	144	1-22, 167-169			22	2	slipknot
view details	+ 3₁	25-163	139	164-167	1-2	3-24	2	3	slipknot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	Trp5 ... Gln137 <-> Bridging ionHg263 <-> Cys206 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His119 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... Gln137 <-> Bridging ionHg263 <-> Glu205 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Gln137 <-> Bridging ionHg263 <-> Cys206 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Gln137 <-> Bridging ionHg263 <-> Cys206 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His119 ... Gln137 <-> Bridging ionHg263 <-> Cys206 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His96 ... Gln137 <-> Bridging ionHg263 <-> Glu205 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His96 <-> Bridging ionZn262 <-> His119 ... Gln137 <-> Bridging ionHg263 <-> Glu205 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence
knots details	K +3₁	Trp5 ... His94 <-> Bridging ionZn262 <-> His119 ... Gln137 <-> Bridging ionHg263 <-> Glu205 ... Chain closurePhe260 <-> Trp5	probabilistic	color sequence

Chain Sequence

WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSETTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling