Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 19-161 143 1-18, 162-220 18 58 slipknot
Fingerprint Knot forming loop Loop type
K +31 Asp63 <->
Bridging ionFe500
<-> Tyr188 ... Cys331 <-> Cys137 ... Asp63
ion-based
K +31 Asp63 <->
Bridging ionFe500
<-> Tyr188 ... Cys227 <-> Cys241 ... Cys331 <-> Cys137 ... Asp63
ion-based
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSQTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling