Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 22-254 233 1-21, 255-257 21 3 knot
Fingerprint Knot forming loop Loop type
K +31 Asp4 ... His94 <->
Bridging ionZn261
<-> His96 ...
Chain closurePhe260 <-> Asp4
 probabilistic
K +31
Chain closureAsp4 <-> Phe260
... Arg67 <->
Bridging ionZn262
<-> His64 ... Asp4		 probabilistic
K +31
Chain closureAsp4 <-> Phe260
... His200 <->
Bridging ionZn262
<-> His64 ... Asp4		 probabilistic
K +31 Asp4 ... His96 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Asp4
 probabilistic
K +31 Asp4 ... His94 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Asp4
 probabilistic
K +31
Chain closureAsp4 <-> Phe260
... His96 <->
Bridging ionZn261
<-> His94 ... Arg67 <->
Bridging ionZn262
<-> His64 ... Asp4		 probabilistic
K +31
Chain closureAsp4 <-> Phe260
... His119 <->
Bridging ionZn261
<-> His96 ... Arg67 <->
Bridging ionZn262
<-> His64 ... Asp4		 probabilistic
K +31
Chain closureAsp4 <-> Phe260
... His119 <->
Bridging ionZn261
<-> His94 ... Arg67 <->
Bridging ionZn262
<-> His64 ... Asp4		 probabilistic
Chain Sequence
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFRVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling