Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 20-220 201 221-222 1-5 6-19 5 1 slipknot
Fingerprint Knot forming loop Loop type
K +31 Thr5 ... His92 <->
Bridging ionZn301
<-> His94 ...
Chain closureGlu226 <-> Thr5
 probabilistic
Chain Sequence
THWGYTGHDSPESWGNLSEEFRLCSTGKNQSPVNITETVSGKLPAIKVNYKPSMVDVENNGHTIQVNYPEGGNTLTVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQPLVLAVLYEAGKTNGRLSSIWNVMPMTAGKVKLNQPFDASTLLPKRLKYYRFAGSLTTPPCTEGVSWLVLKTYDHIDQAQAEKFTRAVGSENNRPVQPLNARVVIE
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling