Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 29-88 60 1-28, 89-98 28 10 knot
Fingerprint Knot forming loop Loop type
K +31 Thr7 ... Cys23 <-> Cys88 ... Cys61 <-> Cys29 ... Trw57 <-> Trp108 ...
Chain closureSer131 <-> Thr7
 probabilistic
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATAS-VASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling