Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 25-255 231 256-258 1-3 4-24 3 2 slipknot
Fingerprint Knot forming loop Loop type
K +31 His3 ... His94 <->
Bridging ionZn601
<-> His96 ... Phe260 <-> His3		 probabilistic
K +31 His3 ... His96 <->
Bridging ionZn601
<-> His119 ... Phe260 <-> His3		 probabilistic
K +31 His3 ... His94 <->
Bridging ionZn601
<-> His119 ... Phe260 <-> His3		 probabilistic
Chain Sequence
HHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHHINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASF
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling