Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 26-232 207 1-25, 233-238 25 6 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureArg1 <-> Lys261
... His120 <->
Bridging ionZn262
<-> His95 ... Arg1		 probabilistic
K +31
Chain closureArg1 <-> Lys261
... His120 <->
Bridging ionZn262
<-> His97 ... Arg1		 probabilistic
K +31
Chain closureArg1 <-> Lys261
... His97 <->
Bridging ionZn262
<-> His95 ... Arg1		 probabilistic
Chain Sequence
RCSHHWGYGKHNGPEHWHKDFPIANGERQSPVDIDTKAVVQDPALKPLALVYGEATSRRMVNNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAAELHLVHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDANPALQKVLDALDSIKTKGKSTDFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAEGEPELLMLANWRPAQPLKNRCVRGFPK
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling