Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 27-254 228 1-26, 255-264 26 10 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGlu4 <-> His267
... His96 <->
Bridging ionZn268
<-> His94 ... Glu4		 probabilistic
K +31
Chain closureGlu4 <-> His267
... His119 <->
Bridging ionZn268
<-> His96 ... Glu4		 probabilistic
K +31
Chain closureGlu4 <-> His267
... His119 <->
Bridging ionZn268
<-> His94 ... Glu4		 probabilistic
Chain Sequence
EWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSSLFPASRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFKHHHHHH
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling