Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 21-253 233 1-20, 254-256 20 2 slipknot
Fingerprint Knot forming loop Loop type
K +31 Trp5 ... His94 <->
Bridging ionZn261
<-> His96 ...
Chain closurePhe260 <-> Trp5
probabilistic
K +31 Trp5 ... His96 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Trp5
probabilistic
K +31 Trp5 ... His94 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Trp5
probabilistic
Chain Sequence
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNQDRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.