Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 20-255 236 1-19, 256-257 19 2 knot
Fingerprint Knot forming loop Loop type
K +31 Asp4 ... His94 <->
Bridging ionZn561
<-> His96 ...
Chain closurePhe260 <-> Asp4
probabilistic
K +31 Asp4 ... His96 <->
Bridging ionZn561
<-> His119 ...
Chain closurePhe260 <-> Asp4
probabilistic
K +31 Asp4 ... His94 <->
Bridging ionZn561
<-> His119 ...
Chain closurePhe260 <-> Asp4
probabilistic
Chain Sequence
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling