Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 29-86 58 1-28, 87-97 28 11 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis12 <-> Asn135
... Trp113 <-> Trq62 ... Cys34 <-> Cys66 ... Cys93 <-> Cys28 ... His12		 probabilistic
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling