Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 17-75 59 1-16, 76-82 16 7 knot
Fingerprint Knot forming loop Loop type
K +31 Glu71 ... Cys75 <-> Cys140 ... Cys113 <-> Cys81 ... Trq109 <-> Trp160 ...
Chain closureLeu179 <-> Glu71
probabilistic
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling