Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 29-87 59 1-28, 88-97 28 10 knot
Fingerprint Knot forming loop Loop type
K +31 His59 ... Cys75 <-> Cys140 ... Cys113 <-> Cys81 ... Ttq109 <-> Trp160 ...
Chain closureAsn182 <-> His59
 probabilistic
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling