Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 19-76 58 1-18, 77-86 18 10 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGlu22 <-> Lys134
... Trp113 <-> Trq62 ... Cys34 <-> Cys66 ... Cys93 <-> Cys28 ... Glu22		 probabilistic
Chain Sequence
EDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAK
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling