Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 16-74 59 1-15, 75-83 15 9 knot
Fingerprint Knot forming loop Loop type
K +31 Glu71 ... Cys75 <-> Cys140 ... Cys113 <-> Cys81 ... Tqq109 <-> Trp160 ...
Chain closureAla180 <-> Glu71
probabilistic
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPIS-IGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling