Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 28-88 61 1-27, 89-98 27 10 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureVal7 <-> Ser131
... Trp108 <-> Trq57 ... Cys29 <-> Cys61 ... Cys88 <-> Cys23 ... Val7		 probabilistic
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATAS-VASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling