Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 27-258 232 1-26, 259-262 26 4 knot
Fingerprint Knot forming loop Loop type
K +31 Ser0 <-> His261 ... His96 <->
Bridging ionZn262
<-> His94 ... Ser0
probabilistic
K +31 Ser0 ... His96 <->
Bridging ionZn262
<-> His119 ... His261 <-> Ser0
probabilistic
K +31 Ser0 ... His94 <->
Bridging ionZn262
<-> His119 ... His261 <-> Ser0
probabilistic
Chain Sequence
SMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.