Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 13-221 209 1-12, 222-225 12 4 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGlu32 <-> Pro279
... His138 <->
Bridging ionMg901
<-> His113 ... Glu32		 probabilistic
K +31
Chain closureGlu32 <-> Pro279
... His113 <->
Bridging ionMg901
<-> His111 ... Glu32		 probabilistic
K +31
Chain closureGlu32 <-> Pro279
... His138 <->
Bridging ionMg901
<-> His111 ... Glu32		 probabilistic
Chain Sequence
EAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNG-TVQISLPSTMRMTVADGTVYIAQQMHFHWGGI----SGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFP
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling