Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 19-254 236 255-256 1-3 4-18 3 1 slipknot
Fingerprint Knot forming loop Loop type
K +31 Cys5 ... His94 <->
Bridging ionZn500
<-> His96 ...
Chain closurePhe260 <-> Cys5
probabilistic
K +31 Cys5 ... His96 <->
Bridging ionZn500
<-> His119 ...
Chain closurePhe260 <-> Cys5
probabilistic
K +31 Cys5 ... His94 <->
Bridging ionZn500
<-> His119 ...
Chain closurePhe260 <-> Cys5
probabilistic
Chain Sequence
CGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGCAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling