Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 16-256 241 257-258 1-1 2-15 1 1 slipknot
Fingerprint Knot forming loop Loop type
K +31 His3 ... His94 <->
Bridging ionZn500
<-> His96 ...
Chain closurePhe260 <-> His3
probabilistic
K +31 His3 ... His96 <->
Bridging ionZn500
<-> His119 ...
Chain closurePhe260 <-> His3
probabilistic
K +31 His3 ... His94 <->
Bridging ionZn500
<-> His119 ...
Chain closurePhe260 <-> His3
probabilistic
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGCAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling