Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 27-257 231 1-26, 258-262 26 5 knot
Fingerprint Knot forming loop Loop type
K +31 Gly1 ... His94 <->
Bridging ionZn263
<-> His96 ...
Chain closureAla262 <-> Gly1
probabilistic
K +31 Gly1 ... Cys54 <-> Cys178 ...
Chain closureAla262 <-> Gly1
probabilistic
K +31 Gly1 ... His96 <->
Bridging ionZn263
<-> His119 ...
Chain closureAla262 <-> Gly1
probabilistic
K +31 Gly1 ... His94 <->
Bridging ionZn263
<-> His119 ...
Chain closureAla262 <-> Gly1
probabilistic
Chain Sequence
GHHGWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling