Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 26-255 230 256-259 1-1 2-25 1 3 slipknot
Fingerprint Knot forming loop Loop type
K +31 Ala2 ... His94 <->
Bridging ionZn261
<-> His96 ...
Chain closureLys260 <-> Ala2
probabilistic
K +31
Chain closureAla2 <-> Lys260
... His119 <->
Bridging ionZn261
<-> His96 ... Ala2
probabilistic
K +31 Ala2 ... His94 <->
Bridging ionZn261
<-> His119 ...
Chain closureLys260 <-> Ala2
probabilistic
Chain Sequence
AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGHTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSSLFPASRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling