Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 27-205 179 206-207 1-1 2-26 1 1 slipknot
Fingerprint Knot forming loop Loop type
K +31 Glu2 ... His89 <->
Bridging ionZn301
<-> His108 ...
Chain closurePhe225 <-> Glu2
probabilistic
K +31 Glu2 ... His91 <->
Bridging ionZn301
<-> His108 ...
Chain closurePhe225 <-> Glu2
probabilistic
K +31 Glu2 ... His89 <->
Bridging ionZn301
<-> His91 ...
Chain closurePhe225 <-> Glu2
probabilistic
Chain Sequence
EWSYEGEKGPEHWAQLKPEFFWCKLKNQSPINIDKKYKVKANLPKLNLYYKTAKESEVVNNGHTIQINIKEDNTLNYLGEKYQLKQFHFHTPSEHTIEKKSYPLEIHFVHKTEDGKILVVGVMAKLGKTNKELDKILNVAPAEEGEKILDKNLNLNNLIPKDKRYMTYSGSLTTPPCTEGVRWIVLKKPISISKQQLEKLKSVMVNPNNRPVQEINSRWIIEGF

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling