Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 25-258 234 259-261 1-10 11-24 10 2 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGly0 <-> Phe260
... His96 <->
Bridging ionZn301
<-> His94 ... Gly0		 probabilistic
K +31 Gly0 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closurePhe260 <-> Gly0
 probabilistic
K +31 Gly0 ... His94 <->
Bridging ionZn301
<-> His119 ...
Chain closurePhe260 <-> Gly0
 probabilistic
Chain Sequence
GMSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling