Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 25-257 233 1-24, 258-260 24 2 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureArg2 <-> His261
... His96 <->
Bridging ionZn301
<-> His94 ... Arg2
probabilistic
K +31 Arg2 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closureHis261 <-> Arg2
probabilistic
K +31 Arg2 ... His94 <->
Bridging ionZn301
<-> His119 ...
Chain closureHis261 <-> Arg2
probabilistic
Chain Sequence
RLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling