Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 21-218 198 1-20, 219-222 20 4 knot
Fingerprint Knot forming loop Loop type
K +31 Ala74 ... His162 <->
Bridging ionZn401
<-> His179 ...
Chain closureLeu310 <-> Ala74
probabilistic
K +31 Ala74 ... His160 <->
Bridging ionZn401
<-> His179 ...
Chain closureLeu310 <-> Ala74
probabilistic
K +31 Ala74 ... His160 <->
Bridging ionZn401
<-> His162 ...
Chain closureLeu310 <-> Ala74
probabilistic
Chain Sequence
AWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling