Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 18-221 204 1-17, 222-223 17 1 slipknot
Fingerprint Knot forming loop Loop type
K +31 Ala73 ... His162 <->
Bridging ionZn401
<-> His179 ...
Chain closureLeu310 <-> Ala73
probabilistic
K +31 Ala73 ... His160 <->
Bridging ionZn401
<-> His179 ...
Chain closureLeu310 <-> Ala73
probabilistic
K +31 Ala73 ... His160 <->
Bridging ionZn401
<-> His162 ...
Chain closureLeu310 <-> Ala73
probabilistic
Chain Sequence
AAWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling