Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 30-210 181 1-29, 211-215 29 5 knot
Fingerprint Knot forming loop Loop type
K +31 Pro75 ... His167 <->
Bridging ionZn401
<-> His184 ...
Chain closureAsp304 <-> Pro75
probabilistic
K +31 Pro75 ... His165 <->
Bridging ionZn401
<-> His184 ...
Chain closureAsp304 <-> Pro75
probabilistic
K +31 Pro75 ... His165 <->
Bridging ionZn401
<-> His167 ...
Chain closureAsp304 <-> Pro75
probabilistic
Chain Sequence
PPHWGYFGEEGPQYWGELAPEFSTCKTGKNQSPINLKPQTAVGTTSLPGFDVYYRETALKLINNGHTLQVNIPLGSYIKINGHRYELLQYHFHTPSEHQRDGFNYPMEMHLVHKDGDGNLAVIAILFQEGEENETLAKLMSFLPQTLKKQEIHESVKIHPAKFFPADKKFYKYSGSLTTPPCSEGVYWMVFKQPIQASVTQLEKMHEYLGSNARPVQRQNARTLLKSWPD

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling