Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 12-192 181 1-11, 193-196 11 4 knot
Fingerprint Knot forming loop Loop type
K +31 Pro35 ... Asp114 <->
Bridging ionNi401
<-> His184 ...
Chain closureAsn298 <-> Pro35
probabilistic
K +31
Chain closurePro35 <-> Asn298
... His189 <->
Bridging ionNi401
<-> His184 ... Pro35
probabilistic
K +31 Pro35 ... Asp114 <->
Bridging ionNi401
<-> His189 ...
Chain closureAsn298 <-> Pro35
probabilistic
Chain Sequence
PDPDDGLTFRVLSMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNPISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLAAFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSAHLIRHHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVALTQIRRSLVDYEVN

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling