Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 24-227 204 1-23, 228-239 23 12 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis140 <-> Arg399
... His251 <->
Bridging ionZn401
<-> His228 ... His140		 probabilistic
K +31
Chain closureHis140 <-> Arg399
... His251 <->
Bridging ionZn401
<-> His226 ... His140		 probabilistic
K +31 His140 ... His226 <->
Bridging ionZn401
<-> His228 ...
Chain closureArg399 <-> His140
 probabilistic
Chain Sequence
HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPR
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling