Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 25-231 207 232-236 1-1 2-24 1 4 slipknot
Fingerprint Knot forming loop Loop type
K +31 Leu5 ... His96 <->
Bridging ionZn301
<-> His121 ...
Chain closureHis263 <-> Leu5
probabilistic
K +31 Leu5 ... His96 <->
Bridging ionZn301
<-> His98 ...
Chain closureHis263 <-> Leu5
probabilistic
K +31 Leu5 ... His98 <->
Bridging ionZn301
<-> His121 ...
Chain closureHis263 <-> Leu5
probabilistic
Chain Sequence
LSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling