Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 116-213 98 1-115, 214-242 115 29 knot
Fingerprint Knot forming loop Loop type
K +31 Tyr90 ... His303 <->
Bridging ionCo402
<-> Glu336 ...
Chain closureSer393 <-> Tyr90
 probabilistic
K +31 Val209 <->
Bridging ionNa405
<-> Ser363 ... Val209		 ion-based
K +31 Asn207 ... Glu336 <->
Bridging ionCo402
<-> Glu367 ... Ser363 <->
Bridging ionNa405
<-> Asn207		 ion-based
K +31 Asn207 <->
Bridging ionNa405
<-> Ser363 ... Glu336 <->
Bridging ionCo402
<-> Asp240 ... Asn207		 ion-based
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLLHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling