Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
- 31 10-58 49 1-9, 59-76 9 18 knot
Fingerprint Knot forming loop Loop type
K -31 Cys11 ... Cys85 <->
Bridging ionZn202
<-> Cys11		 ion-based
K -31 Cys11 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ... Cys85 <->
Bridging ionZn202
<-> Cys11		 ion-based
K -31 Cys11 ... Cys30 <->
Bridging ionZn203
<-> Cys33 ... Cys85 <->
Bridging ionZn202
<-> Cys11		 ion-based
K -31 Cys11 <->
Bridging ionZn202
<-> Cys85 ... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Cys11		 ion-based
K -31 Asp7 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ...
Chain closureLeu91 <-> Asp7
 probabilistic
K -31 Asp7 ... Cys30 <->
Bridging ionZn203
<-> Cys33 ...
Chain closureLeu91 <-> Asp7
 probabilistic
K -31
Chain closureAsp7 <-> Leu91
... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Asp7		 probabilistic
K -31 Cys11 <->
Bridging ionZn202
<-> Cys85 ... Cys75 <->
Bridging ionZn203
<-> Cys72 ... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Cys11		 ion-based
K -31 Cys11 <->
Bridging ionZn202
<-> Cys85 ... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Cys33 <->
Bridging ionZn203
<-> Cys30 ... Cys11		 ion-based
K -31
Chain closureAsp7 <-> Leu91
... Cys75 <->
Bridging ionZn203
<-> Cys72 ... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Asp7		 probabilistic
K -31
Chain closureAsp7 <-> Leu91
... Cys61 <->
Bridging ionZn201
<-> Cys58 ... Cys33 <->
Bridging ionZn203
<-> Cys30 ... Asp7		 probabilistic
Chain Sequence
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling