Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 27-201 175 1-26, 202-205 26 4 knot
Fingerprint Knot forming loop Loop type
K +31 His32 ... His117 <->
Bridging ionZn301
<-> His136 ...
Chain closureAsp253 <-> His32
probabilistic
K +31
Chain closureHis32 <-> Asp253
... His119 <->
Bridging ionZn301
<-> His117 ... His32
probabilistic
K +31 His32 ... His119 <->
Bridging ionZn301
<-> His136 ...
Chain closureAsp253 <-> His32
probabilistic
Chain Sequence
HWSYHGETGPQHWGDLKNEYIMCKIGKNQSPVDISRIVEAELEKIKINYSSGGSSITNNGHTIKVSYEPGSYIIVDGIRFELKQFHFHAPSEHTIKGKSYPFEAHFVHADKDGNLAVIGVIFKEGKKNPIIEKIWENLPEAGKTIKLAHKINAYDLLPKKKKYYRYSGSLTTPPCSEGVRWIVMEEEMELSKEQIEKFRKLMGGDTNRPVQPLNARMIMEMD

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling