Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
- 31 10-58 49 1-9, 59-76 9 18 knot
Fingerprint Knot forming loop Loop type
K -31 Cys11 ... Cys85 <->
Bridging ionZn201
<-> Cys11		 ion-based
K -31 Cys11 <->
Bridging ionZn201
<-> Cys85 ... Cys26 <->
Bridging ionZn202
<-> Cys23 ... Cys11		 ion-based
K -31 Cys11 ... Cys58 <->
Bridging ionZn202
<-> Cys61 ... Cys85 <->
Bridging ionZn201
<-> Cys11		 ion-based
K -31 Cys11 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ... Cys85 <->
Bridging ionZn201
<-> Cys11		 ion-based
K -31 Ala2 ... Cys46 <->
Bridging ionZn201
<-> Cys49 ...
Chain closureGlu101 <-> Ala2
 probabilistic
K -31
Chain closureAla2 <-> Glu101
... Cys26 <->
Bridging ionZn202
<-> Cys23 ... Ala2		 probabilistic
K -31 Ala2 ... Cys58 <->
Bridging ionZn202
<-> Cys61 ...
Chain closureGlu101 <-> Ala2
 probabilistic
K -31 Ala2 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ...
Chain closureGlu101 <-> Ala2
 probabilistic
K -31 Cys11 <->
Bridging ionZn201
<-> Cys85 ... Cys75 <->
Bridging ionZn203
<-> Cys72 ... Cys26 <->
Bridging ionZn202
<-> Cys23 ... Cys11		 ion-based
K -31 Cys11 ... Cys58 <->
Bridging ionZn202
<-> Cys61 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ... Cys85 <->
Bridging ionZn201
<-> Cys11		 ion-based
K -31
Chain closureAla2 <-> Glu101
... Cys49 <->
Bridging ionZn201
<-> Cys46 ... Cys26 <->
Bridging ionZn202
<-> Cys23 ... Ala2		 probabilistic
K -31 Ala2 ... Cys46 <->
Bridging ionZn201
<-> Cys49 ... Cys58 <->
Bridging ionZn202
<-> Cys61 ...
Chain closureGlu101 <-> Ala2
 probabilistic
K -31 Ala2 ... Cys46 <->
Bridging ionZn201
<-> Cys49 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ...
Chain closureGlu101 <-> Ala2
 probabilistic
K -31 Ala2 ... Cys23 <->
Bridging ionZn202
<-> Cys26 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ...
Chain closureGlu101 <-> Ala2
 probabilistic
K -31 Ala2 ... Cys58 <->
Bridging ionZn202
<-> Cys61 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ...
Chain closureGlu101 <-> Ala2
 probabilistic
K -31 Ala2 ... Cys23 <->
Bridging ionZn202
<-> Cys26 ... Cys46 <->
Bridging ionZn201
<-> Cys49 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ...
Chain closureGlu101 <-> Ala2
 probabilistic
K -31 Ala2 ... Cys46 <->
Bridging ionZn201
<-> Cys49 ... Cys58 <->
Bridging ionZn202
<-> Cys61 ... Cys72 <->
Bridging ionZn203
<-> Cys75 ...
Chain closureGlu101 <-> Ala2
 probabilistic
Chain Sequence
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYE
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling