Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 25-257 233 258-261 1-2 3-24 2 3 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureMet1 <-> Lys261
... His96 <->
Bridging ionZn301
<-> His94 ... Met1
probabilistic
K +31 Met1 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closureLys261 <-> Met1
probabilistic
K +31 Met1 ... His94 <->
Bridging ionZn301
<-> His119 ...
Chain closureLys261 <-> Met1
probabilistic
Chain Sequence
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVL-EPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling