Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 26-230 205 1-25, 231-235 25 5 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureSer6 <-> His263
... His121 <->
Bridging ionZn301
<-> His96 ... Ser6
probabilistic
K +31
Chain closureSer6 <-> His263
... His98 <->
Bridging ionZn301
<-> His96 ... Ser6
probabilistic
K +31
Chain closureSer6 <-> His263
... His121 <->
Bridging ionZn301
<-> His98 ... Ser6
probabilistic
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling