Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K

  Help Knotting data interpretation
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 22-253 232 1-21, 254-256 21 3 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureTrp6 <-> Phe261
... His97 <->
Bridging ionZn301
<-> His95 ... Trp6		 probabilistic
K +31 Trp6 ... His97 <->
Bridging ionZn301
<-> His120 ...
Chain closurePhe261 <-> Trp6
 probabilistic
K +31
Chain closureTrp6 <-> Phe261
... His120 <->
Bridging ionZn301
<-> His95 ... Trp6		 probabilistic
Chain Sequence
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling