Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 96-265 170 266-356 1-31 32-95 31 90 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGln2 <-> Gly393
... Gly300 <->
Bridging ionNa402
<-> Thr262 ... Gln2
probabilistic
Chain Sequence
QITNKIHFRNLQGDLFGGVTAAVIALPMALAFGIASGAGATAGLWGAVIVGFFAALFGGTPTLISEPTGPMTVVQTAVIASLVAADPDNGLAMAFTVVMMAGLFQIAFGLLKLGKYVTMMPYTVISGFMSGIGIILVILQLAPFLGQASPKGGVIGTLQALPNLVSNVRPVETLLALMTVGIIWFMPS---KFAPPQLVALVLGTIISITLFGDLDIRRIGEIQAGLPALQLPVFQADQLQRMLIDAAVLGMLGCIDALLTSVVADSLTRTEHNSNKELVGQGIGNVMSGLFGGLGGAGATMGTVVNIQSGGRTALSGLIRAMVLLVVILGAAKLAATIPLAVLAGIAFKVGVDIIDWGFLKVSI----KGALIMYAVIVLTVLVDLIAAVG

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.