Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 23-253 231 1-22, 254-258 22 4 slipknot
Fingerprint Knot forming loop Loop type
K +31 His3 ... His93 <->
Bridging ionZn302
<-> His95 ...
Chain closureLys260 <-> His3
probabilistic
K +31
Chain closureHis3 <-> Lys260
... His118 <->
Bridging ionZn302
<-> His95 ... His3
probabilistic
K +31 His3 ... His93 <->
Bridging ionZn302
<-> His118 ...
Chain closureLys260 <-> His3
probabilistic
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHTFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSHDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSANPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVSKFRKLNFNG-GEPEEPMVDNWRPTQPLKNRQIKASFK

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling